PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 900215
Common NameARALYDRAFT_900215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 262aa    MW: 29870.4 Da    PI: 9.006
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
900215genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.72.4e-3279133358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  k+rY+eC+kNhAas Ggh+vDGCgEfmps geegta++l+CaAC+CHR+FHR+e +
       900215  79 KARYRECQKNHAASSGGHVVDGCGEFMPS-GEEGTAESLRCAACDCHRSFHRKEID 133
                  689*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-3867142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.4E-3080132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.2E-3181132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.06782131IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.91E-17184258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-28188259IPR009057Homeodomain-like
TIGRFAMsTIGR015653.0E-30197254IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEVREKKDEK MEMTRRQSSA LDHHRLPPYT YPQTADKEKP TTKRNGSEPD PDPDLDTNPI  60
SIAPAPRSYV RPQTTSPGKA RYRECQKNHA ASSGGHVVDG CGEFMPSGEE GTAESLRCAA  120
CDCHRSFHRK EIDGLFVVNF NSFGHSQRPL VSRHVSPIMM SFGGGGGAAE SSTEDLNKFH  180
QSFSGNGVDQ FHQYQPKKRF RTKFNEEQKE KMMEFAEKIG WRMTKQEDDE VNRFCREINV  240
KRQVFKVWMH NNKQASKKKD L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-201982551875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064390.0AC006439.4 Arabidopsis thaliana chromosome 2 clone T30D6 map mi39, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002886165.10.0ATHB24
SwissprotQ9ZPW71e-178ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLD7LBB20.0D7LBB2_ARALL; ATHB24
STRINGscaffold_304185.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-172homeobox protein 24